Product overview

Name Streptavidin
Biological description

Streptavidin is a biotin binding protein that is widely used in molecular biology due to its extremely high affinity with the small molecule biotin. Streptavidin can be conjugated with a wide variety of fluorophores and enzymes for use in molecular biology experiments. Streptavidin is a preferred replacement for avidin due to its higher specificty and lower levels of non-specific interactions.

Purity >95%
Special requirements

Specific activity ≥ 15U/mg (one unit binds 1µg of D-Biotin at pH 7.0)

Description

Versatile biotin binding protein widely used in molecular biology

Write Your Own Review
You're reviewing:Streptavidin
Rate this item:

Solubility & Handling

Storage instructions

-20°C

Handling

Reconstitute with dH2O and store at 4°C. Once in solution use within 2 weeks or aliquot and snap freeze for optimal stability.

Important This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. Not for human or veterinary use

Calculators

Molarity

=
x
x
More Info

Dilution

x
=
x
More Info

Chemical Data

Purity >95%
Molecular Weight 52
Sequence (one letter) MRKIVVAAIAVSLTTVSITASASADPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
Modifications Contains no cysteine residues nor glycosylated residues.
CAS Number 9013-20-1
Structure image  Chemical Structure
Appearance Lyophilized powder
Formulation Lyophilized with 10% NaCl (in each 1mg: 900µg is streptavidin and 100µg is NaCl)
Protein length 183 amino acids

References for Streptavidin

References are publications that support the biological activity of the product
  • Cooperative allostery and structural dynamics of streptavidin at cryogenic- and ambient-temperature.

    Ayan E et al (2022) Communications biology 5 : 73
  • Cooperative allostery and structural dynamics of streptavidin at cryogenic- and ambient-temperature.

    Ayan E et al (2022) Communications biology 5 : 73
  • Chemistry of Biotin-Streptavidin and the Growing Concern of an Emerging Biotin Interference in Clinical Immunoassays.

    Luong JHT et al (2020) ACS omega 5 : 10-18

3 Item(s)