Anti-Histone H3 antibody ValidAb™

(HB6980)
Technical documents: SDS Datasheet

Product overview

Name Anti-Histone H3 antibody ValidAb™
Host Rabbit
Clonality Polyclonal
Clonality2 Polyclonal
Target Histone H3
Description

Antibody to Histone H3 - Histone protein used as a loading control for western blotting. Part of the ValidAb™ range of highly validated, data-rich antibodies.

Write Your Own Review
You're reviewing:Anti-Histone H3 antibody ValidAb™
Rate this item:

Validation data

Figure 1. Histone H3 expression in various tissue lysates and preparations.

HB6980 recognises the 14kDa and 16kDa isoforms of Histone H3 in a range of tissues and lysates. Method: mouse brain and rat brain membrane (P2) and cytosol fractions were prepared following previous work (Molnar et al., 1993. Neuroscience 53:307-326) from freshly collected adult brains. Other tissue lysates were prepared following established protocols from freshly dissected tissue (see our guide on WB sample preparation). Samples were loaded (20µg / lane) onto a 20% acrylamide gel alongside a protein ladder (BioRad Precision Plus Dual Colour) before being run at 60V for 30 minutes followed by 100V for 80 minutes then 130V for 40 minutes. Wet transfer to a PVDF membrane was completed in 90 minutes using 400mA. The membrane was blocked for 2hrs in 5% non-fat dry milk before being incubated overnight at 4°C in HB6980 at a 1:1,000 dilution. Following washing, the membrane was incubated in secondary antibody (1:10,000 dilution, Polyclonal goat anti-rabbit HRP conjugated, Sigma, A6154) for 2hrs. For more detail please see our Western blotting protocol. Detection was accomplished using Clarity Western ECL substrate (BioRad, 1705061) and a Licor Odyssey Fc imaging system (ECL channel: 6 min exposure, 700nm channel: 30 sec exposure). Following imaging the membrane was stripped with two changes of stripping buffer (HB7756) before being washed, blocked for 2 hours in 5% non-fat dry milk and incubated in HB9177 (mouse monoclonal anti-GAPDH, 1:4,000 dilution, 0.25µg/ml) and HB8224 (rabbit polyclonal anti-ß-actin, 1:1,000 dilution) overnight at 4°C. Following washing the membrane was incubated in a 1:10,000 dilution of polyclonal goat anti-mouse HRP conjugated (Sigma Aldrich A3682) and polyclonal goat anti-rabbit HRP (Sigma Aldrich A6154) conjugated secondary antibodies for 2hrs and visualised again using Clarity Western ECL substrate (BioRad, 1705061) and a Licor Odyssey Fc imaging system (ECL channel: 4 min exposure, 700nm channel: 30 sec exposure).

Figure 2. Concentration response of HB6980 staining in a rat brain cytosol preparation.

HB6980 shows strong affinity for Histone H3 with bands visible at as low a concentration as 8.75ng/ml (1:64,000 dilution). Method: cytosol fractions were prepared from fresh rat brains following established protocols (Molnar et al., 1993. Neuroscience 53:307-326). Rat cytosol samples were loaded (20µg / lane) onto a 20% acrylamide gel alongside a protein ladder (BioRad Precision Plus Dual Colour) before being run at 60V for 30 minutes followed by 120V for 100 minutes. Wet transfer to a PVDF membrane was completed in 90 minutes using 400mA. Following transfer the membrane was cut into strips using Ponceau dye to visualise and cut individual lanes. Strips were blocked for 2hrs in 5% non-fat dry milk before being incubated overnight at 4°C in HB6980. Each strip was incubated separately with a separate HB6980 concentration with this ranging from 1:500 to 1:128,000 dilutions (4.38 – 1120ng/ml). Following washing, the membrane was incubated in secondary antibody (1:10,000 dilution, Polyclonal goat anti-rabbit HRP conjugated, Sigma, A6154) for 2hrs. For more detail please see our Western blotting protocol. Detection was accomplished using Clarity Western ECL substrate (BioRad, 1705061) and a Licor Odyssey Fc imaging system (ECL channel: 8 min exposure, 700nm channel: 30 sec exposure). Band intensity was calculated using Image Studio version 5.2.5 (LiCor) and a graph was constructed in GraphPad Prism 9 using a 3-parameter Hill equation curve fit.

Product information

Immunogen

Synthetic peptide consisting of residues from within the C-terminus of human Histone H3. The sequence of the immunogen is: REIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA

Isotype IgG
Purification

Immunogen affinity chromatography

Concentration 0.56 mg/mL
Formulation PBS with 0.01% thiomersal and 50% glycerol, pH7.3
Predicted species reactivity Mouse, Rat, Human
Tested species reactivity Mouse, Rat

Tested applications

Applications WB
Western blot optimal concentration

280ng/ml (1:2,000 dilution) as tested in a rat brain cytosol preparation

Positive control

Histone H3 is found in the nucleus of all cell types therefore any tissue or cell line can serve as a positive control. 

Negative control

Any negative control tissues or cells must not contain any nuclei therefore red blood cells or platelets can work well in adittion to samples that have undergone subcellular fractionation to remove any nuclei.

Open data link

Please follow this link to OSF.

Target information

Other names

H3F3, H3

UniProt ID A2348
Structure image  Chemical Structure
Gene name H3-4
NCBI full gene name H3.4 histone, cluster member
Entrez gene ID

8290

Amino acids

136 (15.5kDa)

Isoforms

Histone H3 has 21 family members with this antibody having an immunogen based upon Histone H3.1t. This family member has no known isoforms. Please note that this antibody is not isoform specific.

Expression

Histone H3 is a ubiquitous protein that is expressed in almost all eukaryotic cells throughout the body. It is found in the nuclei of cells in various tissues and organs, including but not limited to the brain, heart, liver, lungs, kidneys, and skin.

Subcellular expression

Histone H3 proteins are expressed in the nucleus where they form the structure of chromatin around which DNA wounds.

Processing

Prior to forming an active conformation the initiator methionine is removed.

Post translational modifications

Histone H3 proteins are subject to numerous post-translational modifications which mediate epigenetic control of gene expression. These modifications include methylation, acetylation and phosphorylation on multiple residues amongst other modifications.

Homology (compared to human)

Compared to human Histone H3.1t:

  • Histone H3.1 was the closest homologue in mice with a 97.1% identity score
  • Histone H3.1t was the closest homologue in rats with a 97.1% identity score.
Similar proteins

In a BLAST search no non-Histone H3 family members were identified as having significant homology with Histone H3.1t

Epitope homology (between species)

A BLAST search of the immunogen reveals a 96.55% homology with mouse and rat Histone H3.1

Epitope homology (other proteins)

A BLAST search of the immunogen shows that the only proteins with homology to it are Histone H3 family members.

Storage & Handling

Storage instructions

-20°C

Important This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. Not for human or veterinary use

References for Anti-Histone H3 antibody ValidAb™

References are publications that support the biological activity of the product
  • Interactions With Histone H3 & Tools to Study Them.

    Scott WA et al (2020) Frontiers in cell and developmental biology 8 : 701
  • Histone H3 lysine K4 methylation and its role in learning and memory.

    Collins BE et al (2019) Epigenetics & chromatin 12 : 7
  • The double face of the histone variant H3.3.

    Szenker E et al (2011) Cell research 21 : 421-34
  • Insights into the role of histone H3 and histone H4 core modifiable residues in Saccharomyces cerevisiae.

    Hyland EM et al (2005) Molecular and cellular biology 25 : 10060-70
  • Regulation of chromatin structure by site-specific histone H3 methyltransferases.

    Rea S et al (2000) Nature 406 : 593-9