β-Amyloid Peptide (42-1) (human)

(HB9159)

Certificate of Analysis

Latest Certificate of Analysis

Download the latest CoA for this product:

Download CoA

Download Batch-Specific CoA

To download the CoA for a batch, enter the batch ID below:

Technical documents: CoA SDS Protocol Datasheet
1  Review
Top Reviews:
100% of 100
Add Your Review

Product overview

Name β-Amyloid Peptide (42-1) (human)
Biological description

Inactive control peptide for β-Amyloid Peptide (1-42).

Alternative names Aβ42-1
Purity >95%
Description β-Amyloid Peptide (1-42) inactive control.
Write Your Own Review
You're reviewing:β-Amyloid Peptide (42-1) (human)
Rate this item:

Biological Data

Application notes

Please see our Amyloid Beta Protocol

Solubility & Handling

Storage instructions -20°C
Solubility overview Soluble in 1.0% NH4OH
Handling

Please note that this product is supplied as a lyophilized solid and may be very hard to visualize.

Amyloid beta peptides are prone to aggregation and as such, there are a variety of published methods for handling amyloid beta peptides.

We recommend using NH4OH with this product - you should use 1.0% NH4OH as the solvent followed by buffer (for example 1X PBS).

  1. Add 1.0% NH4OH directly to the lyophilized peptide (~70-80 μl for 1mg of peptide). Do not store the peptide in 1.0% NH4OH.
  2. Immediately dilute your solution to a concentration of ~1mg/mL or less with 1X PBS or alternative buffer.
  3. Vortex gently to mix (less than 1 minute).

Note: This method may not completely remove pre-aggregates. Vortexing may encourage seeding and further aggregation of the peptide.

Shipping Conditions Stable for ambient temperature shipping. Follow storage instructions on receipt.
Important This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. Not for human or veterinary use

Calculators

Molarity

=
x
x
More Info

Dilution

x
=
x
More Info

Chemical Data

Purity >95%
Chemical name AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Molecular Weight 4514.08
Chemical structure Amyloid beta 42-1 [317366-82-8] Chemical Structure
Molecular Formula C203H311N55O60S
Sequence (one letter) AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Modifications N/A
CAS Number 317366-82-8
PubChem identifier 71581486
SMILES CCC(C)[C@@H](C(=O)N[C@@H](C(C)CC)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@H](C(C)C)C(=O)N[C@H](CC(=O)O)C(=O)N[C@H](CCC(=O)O)C(=O)N[C@H](C)C(=O)N[C@H](CC1=CC=CC=C1)C(=O)N[C@H](CC2=CC=CC=C2)C(=O)N[C@H](C(C)C)C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N[C@H](CCC(=O)N)C(=O)N[C@H](CC3=CNC=N3)C(=O)N[C@H](CC4=CNC=N4)C(=O)N[C@H](C(C)C)C(=O)N[C@H](CCC(=O)O)C(=O)N[C@H](CC5=CC=C(C=C5)O)C(=O)NCC(=O)N[C@H](CO)C(=O)N[C@H](CC(=O)O)C(=O)N[C@H](CC6=CNC=N6)C(=O)N[C@H](CCCNC(=N)N)C(=O)N[C@H](CC7=CC=CC=C7)C(=O)N[C@H](CCC(=O)O)C(=O)N[C@H](C)C(=O)N[C@H](CC(=O)O)C(=O)O)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCSC)NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)CNC(=O)[C@H](C(C)C)NC(=O)[C@H](C(C)C)NC(=O)[C@H](C(C)CC)NC(=O)[C@H](C)N
InChiKey QBEAMNLSDYIUGM-TYMWQTOHSA-N
Appearance Lyophilized White solid
Protein length 42

References for β-Amyloid Peptide (42-1) (human)

References are publications that support the biological activity of the product
  • Amyloidogenicity and toxicity of the reverse and scrambled variants of amyloid-β 1-42.

    Vadukul et al (2017) FEBS Lett. 591(5) : 822-830

1 Item