The store will not work correctly in the case when cookies are disabled.
Solubility & Handling
| Storage instructions | -20°C |
| Solubility overview | Soluble in 1.0% NH4OH |
| Handling | Please note that this product is supplied as a lyophilized solid and may be very hard to visualize.
Amyloid beta peptides are prone to aggregation and as such, there are a variety of published methods for handling amyloid beta peptides.
We recommend using NH4OH with this product - you should use 1.0% NH4OH as the solvent followed by buffer (for example 1X PBS).
- Add 1.0% NH4OH directly to the lyophilized peptide (~70-80 μl for 1mg of peptide). Do not store the peptide in 1.0% NH4OH.
- Immediately dilute your solution to a concentration of ~1mg/mL or less with 1X PBS or alternative buffer.
- Vortex gently to mix (less than 1 minute).
Note: This method may not completely remove pre-aggregates. Vortexing may encourage seeding and further aggregation of the peptide. |
| Important | This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. Not for human or veterinary use |
Chemical Data
| Chemical name | AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD |
| Chemical structure | ![Amyloid beta 42-1 [317366-82-8] Chemical Structure](data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAAAEAAAABCAQAAAC1HAwCAAAAC0lEQVR4nGP6zwAAAgcBApocMXEAAAAASUVORK5CYII= "Amyloid beta 42-1 [317366-82-8]") |
| Molecular Formula | C203H311N55O60S |
| Sequence (one letter) | AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD |
| PubChem identifier | 71581486 |
| SMILES | CCC(C)[C@@H](C(=O)N[C@@H](C(C)CC)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@H](C(C)C)C(=O)N[C@H](CC(=O)O)C(=O)N[C@H](CCC(=O)O)C(=O)N[C@H](C)C(=O)N[C@H](CC1=CC=CC=C1)C(=O)N[C@H](CC2=CC=CC=C2)C(=O)N[C@H](C(C)C)C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N[C@H](CCC(=O)N)C(=O)N[C@H](CC3=CNC=N3)C(=O)N[C@H](CC4=CNC=N4)C(=O)N[C@H](C(C)C)C(=O)N[C@H](CCC(=O)O)C(=O)N[C@H](CC5=CC=C(C=C5)O)C(=O)NCC(=O)N[C@H](CO)C(=O)N[C@H](CC(=O)O)C(=O)N[C@H](CC6=CNC=N6)C(=O)N[C@H](CCCNC(=N)N)C(=O)N[C@H](CC7=CC=CC=C7)C(=O)N[C@H](CCC(=O)O)C(=O)N[C@H](C)C(=O)N[C@H](CC(=O)O)C(=O)O)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCSC)NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)CNC(=O)[C@H](C(C)C)NC(=O)[C@H](C(C)C)NC(=O)[C@H](C(C)CC)NC(=O)[C@H](C)N |
| InChiKey | QBEAMNLSDYIUGM-TYMWQTOHSA-N |
| Appearance | Lyophilized White solid |
References for β-Amyloid Peptide (42-1) (human)
References are publications that support the biological activity of the product
-
Amyloidogenicity and toxicity of the reverse and scrambled variants of amyloid-β 1-42.
Vadukul et al (2017) FEBS Lett. 591(5) : 822-830
β-Amyloid Peptide (1-42) inactive control.
![Amyloid beta 42-1 [317366-82-8] Chemical Structure](https://hellobio.com/media/catalog/product//h/b/hb4873_1.png "Amyloid beta 42-1 [317366-82-8]")
Understanding purity and quality - a guide for life scientists
