β-Amyloid Peptide (1-40) (human)
(HB8758)
Product overview
| Name | β-Amyloid Peptide (1-40) (human) |
| Description | β-Amyloid (1-40) protein fragment. |
| Biological description | The β-Amyloid (1-40) peptide is one of the two main amyloid-β peptides implicated in Alzheimer's disease. |
| Alternative names | Aβ1-40, Aβ40 |
Write Your Own Review
Solubility & Handling
| Storage instructions | -20°C |
| Solubility overview | Soluble in 1.0% NH4OH |
| Handling | Please note that this product is supplied as a lyophilized solid and may be very hard to visualize. Amyloid beta peptides are prone to aggregation and as such, there are a variety of published methods for handling amyloid beta peptides. We recommend using NH4OH with this product - you should use 1.0% NH4OH as the solvent followed by buffer (for example 1X PBS).
Note: This method may not completely remove pre-aggregates. Vortexing may encourage seeding and further aggregation of the peptide. |
| Important | This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. Not for human or veterinary use |
Chemical Data
| Chemical name | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Molecular Weight | 4329.86 |
| Chemical structure | ![Amyloid beta 1-40 TFA [131438-79-4] Chemical Structure](https://hellobio.com/media/catalog/product//h/b/hb4871_1.png "Amyloid beta 1-40 TFA [131438-79-4]") |
| Molecular Formula | C194H295N53O58S |
| Sequence (one letter) | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| CAS Number | 131438-79-4 |
| PubChem identifier | 131954545 |
| SMILES | CCC(C)C(C(=O)NC(C(C)CC)C(=O)NCC(=O)NC(CC(C)C)C(=O)NC(CCSC)C(=O)NC(C(C)C)C(=O)NCC(=O)NCC(=O)NC(C(C)C)C(=O)NC(C(C)C)C(=O)O)NC(=O)C(C)NC(=O)CNC(=O)C(CCCCN)NC(=O)C(CC(=O)N)NC(=O)C(CO)NC(=O)CNC(=O)C(C(C)C)NC(=O)C(CC(=O)O)NC(=O)C(CCC(=O)O)NC(=O)C(C)NC(=O)C(CC1=CC=CC=C1)NC(=O)C(CC2=CC=CC=C2)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CCCCN)NC(=O)C(CCC(=O)N)NC(=O)C(CC3=CNC=N3)NC(=O)C(CC4=CNC=N4)NC(=O)C(C(C)C)NC(=O)C(CCC(=O)O)NC(=O)C(CC5=CC=C(C=C5)O)NC(=O)CNC(=O)C(CO)NC(=O)C(CC(=O)O)NC(=O)C(CC6=CNC=N6)NC(=O)C(CCCNC(=N)N)NC(=O)C(CC7=CC=CC=C7)NC(=O)C(CCC(=O)O)NC(=O)C(C)NC(=O)C(CC(=O)O)N |
| InChiKey | FEWOUVRMGWFWIH-UHFFFAOYSA-N |
| MDL number | MFCD00130509 |
| Appearance | Lyophilized white powder |
| Protein length | 40 |
References for β-Amyloid Peptide (1-40) (human)
References are publications that support the biological activity of the product
-
Plasma amyloid Beta 40/42 ratio predicts cerebral amyloidosis in cognitively normal individuals at risk for Alzheimer's disease
Vergallo A et al (2019) Alzheimers Dement 15(6) : 764-775 -
High-precision plasma Beta-amyloid 42/40 predicts current and future brain amyloidosis
Schindler SE et al (2019) Neurology : doi: 10.1212/WNL.000000000000808 -
Amyloid Beta-peptides 1-40 and 1-42 form oligomers with mixed β-sheets
Baldassarre M et al (2017) Chem Sci 8(12) : 8247-8254
Technical guides
Understanding purity and quality - a guide for life scientistsRelated Products
Related Products
- Code:
- HB9805
β-Amyloid (1-42) protein fragment. Implicated in Alzheimer's disease.