β-Amyloid Peptide (1-40) (human)

(HB8758)

Certificate of Analysis

Latest Certificate of Analysis

Download the latest CoA for this product:

Download CoA

Download Batch-Specific CoA

To download the CoA for a batch, enter the batch ID below:

Technical documents: CoA SDS Protocol Datasheet

Product overview

Name β-Amyloid Peptide (1-40) (human)
Biological description

The β-Amyloid (1-40) peptide is one of the two main amyloid-β peptides implicated in Alzheimer's disease.

Alternative names Aβ1-40, Aβ40
Purity >95%
Description β-Amyloid (1-40) protein fragment.
Write Your Own Review
You're reviewing:β-Amyloid Peptide (1-40) (human)
Rate this item:

Biological Data

Application notes

Please see our Amyloid Beta Protocol

Solubility & Handling

Storage instructions -20°C
Solubility overview Soluble in 1.0% NH4OH
Handling

Please note that this product is supplied as a lyophilized solid and may be very hard to visualize.

Amyloid beta peptides are prone to aggregation and as such, there are a variety of published methods for handling amyloid beta peptides.

We recommend using NH4OH with this product - you should use 1.0% NH4OH as the solvent followed by buffer (for example 1X PBS).

  1. Add 1.0% NH4OH directly to the lyophilized peptide (~70-80 μl for 1mg of peptide). Do not store the peptide in 1.0% NH4OH.
  2. Immediately dilute your solution to a concentration of ~1mg/mL or less with 1X PBS or alternative buffer.
  3. Vortex gently to mix (less than 1 minute).

Note: This method may not completely remove pre-aggregates. Vortexing may encourage seeding and further aggregation of the peptide.

Shipping Conditions Stable for ambient temperature shipping. Follow storage instructions on receipt.
Important This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. Not for human or veterinary use

Calculators

Molarity

=
x
x
More Info

Dilution

x
=
x
More Info

Chemical Data

Purity >95%
UniProt ID P05067
Chemical name DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight 4329.86
Chemical structure Amyloid beta 1-40 TFA [131438-79-4] Chemical Structure
Molecular Formula C194H295N53O58S
Sequence (one letter) DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
CAS Number 131438-79-4
PubChem identifier 131954545
SMILES CCC(C)C(C(=O)NC(C(C)CC)C(=O)NCC(=O)NC(CC(C)C)C(=O)NC(CCSC)C(=O)NC(C(C)C)C(=O)NCC(=O)NCC(=O)NC(C(C)C)C(=O)NC(C(C)C)C(=O)O)NC(=O)C(C)NC(=O)CNC(=O)C(CCCCN)NC(=O)C(CC(=O)N)NC(=O)C(CO)NC(=O)CNC(=O)C(C(C)C)NC(=O)C(CC(=O)O)NC(=O)C(CCC(=O)O)NC(=O)C(C)NC(=O)C(CC1=CC=CC=C1)NC(=O)C(CC2=CC=CC=C2)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CCCCN)NC(=O)C(CCC(=O)N)NC(=O)C(CC3=CNC=N3)NC(=O)C(CC4=CNC=N4)NC(=O)C(C(C)C)NC(=O)C(CCC(=O)O)NC(=O)C(CC5=CC=C(C=C5)O)NC(=O)CNC(=O)C(CO)NC(=O)C(CC(=O)O)NC(=O)C(CC6=CNC=N6)NC(=O)C(CCCNC(=N)N)NC(=O)C(CC7=CC=CC=C7)NC(=O)C(CCC(=O)O)NC(=O)C(C)NC(=O)C(CC(=O)O)N
Structure image Amyloid beta 1-40 TFA [131438-79-4] Chemical Structure
InChiKey FEWOUVRMGWFWIH-UHFFFAOYSA-N
MDL number MFCD00130509
Appearance Lyophilized white powder
Protein length 40

References for β-Amyloid Peptide (1-40) (human)

References are publications that support the biological activity of the product
  • Plasma amyloid Beta 40/42 ratio predicts cerebral amyloidosis in cognitively normal individuals at risk for Alzheimer's disease

    Vergallo A et al (2019) Alzheimers Dement 15(6) : 764-775
  • High-precision plasma Beta-amyloid 42/40 predicts current and future brain amyloidosis

    Schindler SE et al (2019) Neurology : doi: 10.1212/WNL.000000000000808
  • Amyloid Beta-peptides 1-40 and 1-42 form oligomers with mixed β-sheets

    Baldassarre M et al (2017) Chem Sci 8(12) : 8247-8254

3 Item(s)