Galanin (1-30) (human)

(HB3238)

Certificate of Analysis

Latest Certificate of Analysis

Download the latest CoA for this product:

Download CoA

Download Batch-Specific CoA

To download the CoA for a batch, enter the batch ID below:

Technical documents: CoA Datasheet

Product overview

Name Galanin (1-30) (human)
Biological description

Endogenous galanin receptor agonist peptide with high affinity for galanin receptors. Shows various endocrine, metabolic and behavioural effects and has been shown to show effect various processes such as apeptite, nociception, sleep regulation, cognition, synpatic transmission and insulin and somatostatin release.

Purity >95%
Description

Endogenous galanin receptor agonist

Write Your Own Review
You're reviewing:Galanin (1-30) (human)
Rate this item:

Solubility & Handling

Storage instructions -20°C
Solubility overview

Soluble in water (1 mg/ml)

Storage of solutions Prepare and use solutions on the same day if possible. Store solutions at -20°C for up to one month if storage is required. Equilibrate to RT and ensure the solution is precipitate free before use.
Shipping Conditions Stable for ambient temperature shipping. Follow storage instructions on receipt.
Important This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. Not for human or veterinary use

Calculators

Molarity

=
x
x
More Info

Dilution

x
=
x
More Info

Chemical Data

Purity >95%
Chemical name H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-OH
Molecular Weight 3157.41
Molecular Formula C139H210N42O43
Sequence (one letter) GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
CAS Number 119418-04-1
PubChem identifier 16133823
InChiKey CBSXZYWGVAQSHI-RUKUCZSXSA-N
Appearance White solid

References for Galanin (1-30) (human)

References are publications that support the biological activity of the product
  • Physiology, signaling, and pharmacology of galanin peptides and receptors: three decades of emerging diversity.

    Lang R et al (2015) Pharmacological reviews 67 : 118-75
  • Molecular characterization of the ligand binding site of the human galanin receptor type 2, identifying subtype selective interactions.

    Lundström L et al (2007) Journal of neurochemistry 103 : 1774-84
  • Cloning and expression of the human galanin receptor GalR2.

    Bloomquist BT et al (1998) Biochemical and biophysical research communications 243 : 474-9

3 Item(s)