The store will not work correctly in the case when cookies are disabled.
JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.
Solubility & Handling Storage instructions -20°C
Solubility overview Soluble in water (1 mg/ml)
Important This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. Not for human or veterinary use
Chemical Data Chemical name H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-OH
Molecular Formula C139 H210 N42 O43
Sequence (one letter) GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
PubChem identifier 16133823
InChiKey CBSXZYWGVAQSHI-RUKUCZSXSA-N
References for Galanin (1-30) (human) References are publications that support the biological activity of the product
Physiology, signaling, and pharmacology of galanin peptides and receptors: three decades of emerging diversity. Lang R et al (2015) Pharmacological reviews 67 : 118-75 Molecular characterization of the ligand binding site of the human galanin receptor type 2, identifying subtype selective interactions. Lundström L et al (2007) Journal of neurochemistry 103 : 1774-84 Cloning and expression of the human galanin receptor GalR2. Bloomquist BT et al (1998) Biochemical and biophysical research communications 243 : 474-9
Endogenous galanin receptor agonist
Understanding purity and quality - a guide for life scientists
