Product overview
| Name | α-Bungarotoxin |
| Description | α7 subtype selective nAChR antagonist |
| Biological description | Irreversible, high affinity nicotinic acethylcholine receptor (nAChR) antagonist. Neurotoxin. Shows subtype selectivity for α7 over α3β4 receptors. Shows activity at the heteromeric muscle receptors (αβγδ or αβδε subunits) and neuronal subtypes (α7, α8, α9 subunits, (IC50 values are 1.6 nM and > 3 μM respectively). Prevents opening of nicotinic receptor-associated ion channels and blocks neuromuscular transmission. Additionally acts as an imaging tool for fluorophore- labeling studies. |
| Alternative names | α-BTX, α-Bgtx, α-BuTX, BGT |
| Purity | >99% |
Write Your Own Review
Solubility & Handling
| Storage instructions | -20°C (desiccate) |
| Solubility overview | Soluble in water |
| Important | This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. Not for human or veterinary use. |
Chemical Data
| Chemical name | IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG |
| Molecular Weight | 7984 |
| Molecular Formula | C338H529N97O105S11 |
| CAS Number | 11032-79-4 |
| PubChem identifier | 90488742 |
| SMILES | [H]N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H]3CCCN3C(=O)[C@@H]3CCCN3C(=O)[C@H](CSSC[C@H](NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC4=CC=C(O)C=C4)NC2=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC2=CC=CC=C2)C(=O)N3)C(C)C)C(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@H]2CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC3=CC=C(O)C=C3)NC(=O)[C@@H]3CCCN3C(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@@H]3CCCN3C2=O)C(C)C)[C@@H](C)O)C(=O)N[C@H]2CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CO)NC2=O)[C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N2CCC[C@H]2C(=O)N[C@@H](CC2=CNC=N2)C(=O)N2CCC[C@H]2C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N2CCC[C@H]2C(=O)NCC(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@@H]2CCCN2C(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CC2=CNC=N2)NC1=O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)CC)C(C)C)[C@@H](C)O |
| Source | Bungarus multicinctus |
| InChiKey | NTCJKZSYQTZRQE-CSMGIIAWSA-N |
References for α-Bungarotoxin
References are publications that support the biological activity of the product
-
Snake neurotoxin α-bungarotoxin is an antagonist at native GABA(A) receptors.
Hannan et al (2015) Neuropharmacology 93 : 28-40 -
Inter-residue coupling contributes to high-affinity subtype-selective binding of α-bungarotoxin to nicotinic receptors.
Sine et al (2013) Biochem J 454(2) : 311-21 -
Neuronal acetylcholine receptors that bind alpha-bungarotoxin with high affinity function as ligand-gated ion channels.
Zhang et al (1994) Neuron 12(1) : 167-77 -
Identification of regions involved in the binding of alpha-bungarotoxin to the human alpha7 neuronal nicotinic acetylcholine receptor using synthetic peptides.
Marinou et al (12614199) Biochem J 372 : 543-54
Technical Guides
Understanding purity and quality - a guide for life scientistsRelated Products
Related Products
- Code:
- HB0443
Potent, selective, competitive AMPA receptor antagonist. Disodium salt.