Product overview

Name α-Bungarotoxin
Description α7 subtype selective nAChR antagonist
Biological description

Irreversible, high affinity nicotinic acethylcholine receptor (nAChR) antagonist. Neurotoxin. Shows subtype selectivity for α7 over α3β4 receptors.

Shows activity at the heteromeric muscle receptors (αβγδ or αβδε subunits) and neuronal subtypes (α7, α8, α9 subunits, (IC50 values are 1.6 nM and > 3 μM respectively).

Prevents opening of nicotinic receptor-associated ion channels and blocks neuromuscular transmission. Additionally acts as an imaging tool for fluorophore- labeling studies.

Alternative names α-BTX, α-Bgtx, α-BuTX, BGT
Purity >99%
Write Your Own Review
You're reviewing:α-Bungarotoxin
Rate this item:

Solubility & Handling

Storage instructions -20°C (desiccate)
Solubility overview Soluble in water
Important This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. Not for human or veterinary use.

Calculators

Molarity

=
x
x
More Info

Dilution

x
=
x
More Info

Chemical Data

Chemical name IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Molecular Weight 7984
Molecular Formula C338H529N97O105S11
CAS Number 11032-79-4
PubChem identifier 90488742
SMILES [H]N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H]3CCCN3C(=O)[C@@H]3CCCN3C(=O)[C@H](CSSC[C@H](NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC4=CC=C(O)C=C4)NC2=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC2=CC=CC=C2)C(=O)N3)C(C)C)C(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@H]2CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC3=CC=C(O)C=C3)NC(=O)[C@@H]3CCCN3C(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@@H]3CCCN3C2=O)C(C)C)[C@@H](C)O)C(=O)N[C@H]2CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CO)NC2=O)[C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N2CCC[C@H]2C(=O)N[C@@H](CC2=CNC=N2)C(=O)N2CCC[C@H]2C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N2CCC[C@H]2C(=O)NCC(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@@H]2CCCN2C(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CC2=CNC=N2)NC1=O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)CC)C(C)C)[C@@H](C)O
Source Bungarus multicinctus
InChiKey NTCJKZSYQTZRQE-CSMGIIAWSA-N

References for α-Bungarotoxin

References are publications that support the biological activity of the product
  • Snake neurotoxin α-bungarotoxin is an antagonist at native GABA(A) receptors.

    Hannan et al (2015) Neuropharmacology 93 : 28-40
  • Inter-residue coupling contributes to high-affinity subtype-selective binding of α-bungarotoxin to nicotinic receptors.

    Sine et al (2013) Biochem J 454(2) : 311-21
  • Neuronal acetylcholine receptors that bind alpha-bungarotoxin with high affinity function as ligand-gated ion channels.

    Zhang et al (1994) Neuron 12(1) : 167-77
  • Identification of regions involved in the binding of alpha-bungarotoxin to the human alpha7 neuronal nicotinic acetylcholine receptor using synthetic peptides.

    Marinou et al (12614199) Biochem J 372 : 543-54