tatM2NX

(HB7349)

Certificate of Analysis

Latest Certificate of Analysis

Download the latest CoA for this product:

Download CoA

Download Batch-Specific CoA

To download the CoA for a batch, enter the batch ID below:

Technical documents: CoA SDS Datasheet

Product overview

Name tatM2NX
Biological description

Novel, potent and cell permeable TRPM2 antagonist (IC50 = 396nM). Prevents ligand binding and TRPM2 activation. Inhibits over 90% of human TRPM2 channel currents at concentrations as low as 2 μM. Shows neuroprotective effects in animal models of focal and global ischemia. Active in vivo.

Purity >93%
Description

TRPM2 antagonist. Cell permeable.

Write Your Own Review
You're reviewing:tatM2NX
Rate this item:

Solubility & Handling

Storage instructions -20°C
Solubility overview

Soluble in aqueous buffer

Storage of solutions Prepare and use solutions on the same day if possible. Store solutions at -20°C for up to one month if storage is required. Equilibrate to RT and ensure the solution is precipitate free before use.
Shipping Conditions Stable for ambient temperature shipping. Follow storage instructions on receipt.
Important This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. Not for human or veterinary use

Calculators

Molarity

=
x
x
More Info

Dilution

x
=
x
More Info

Chemical Data

Purity >93%
Molecular Weight 4354.17
Molecular Formula C190H323N71O45S
Sequence (one letter) YGRKKRRQRRRGSREPGEMLPRKLKRVLRQEFWV
Sequence (three letter) H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Ser-Arg-Glu-Pro-Gly-Glu-Met-Leu-Pro-Arg-Lys-Leu-Lys-Arg-Val-Leu-Arg-Gln-Glu-Phe-Trp-Val-OH

References for tatM2NX

References are publications that support the biological activity of the product
  • Characterization and Optimization of the Novel Transient Receptor Potential Melastatin 2 Antagonist tatM2NX.

    Cruz-Torres I et al (2020) Molecular pharmacology 97 : 102-111
  • Extended therapeutic window of a novel peptide inhibitor of TRPM2 channels following focal cerebral ischemia.

    Shimizu T et al (2016) Experimental neurology 283 : 151-6

2 Item(s)