The store will not work correctly in the case when cookies are disabled.
JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.
Solubility & Handling Storage instructions -20°C
Solubility overview Soluble in aqueous buffer
Important This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. Not for human or veterinary use
Chemical Data Molecular Formula C190 H323 N71 O45 S
Sequence (one letter) YGRKKRRQRRRGSREPGEMLPRKLKRVLRQEFWV
Sequence (three letter) H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Ser-Arg-Glu-Pro-Gly-Glu-Met-Leu-Pro-Arg-Lys-Leu-Lys-Arg-Val-Leu-Arg-Gln-Glu-Phe-Trp-Val-OH
References for tatM2NX References are publications that support the biological activity of the product
Characterization and Optimization of the Novel Transient Receptor Potential Melastatin 2 Antagonist tatM2NX. Cruz-Torres I et al (2020) Molecular pharmacology 97 : 102-111 Extended therapeutic window of a novel peptide inhibitor of TRPM2 channels following focal cerebral ischemia. Shimizu T et al (2016) Experimental neurology 283 : 151-6
TRPM2 antagonist. Cell permeable.
Understanding purity and quality - a guide for life scientists
