Product overview

Name Neuropeptide Y (human,rat)
Biological description

Neuropeptide Y (NPY) is a 36-amino acid endogenous neuropeptide which is involved in a variety of physiological and homeostatic processes. It is widely distributed in the CNS and is one of the most abundant peptides found in the brain. It is also distributed in the PNS.


 The NPY neuropeptide is active in vivo and has been shown to be involved in obesity and food intake, stress, anxiety, depression, epilepsy, pain, neurodegeneration and cardiovascular regulation.

NPY is a potent orexigenic peptide which stimulates food intake.

Alternative names NPY
Purity >95%
Description Widely distributed endogenous neuropeptide
Write Your Own Review
You're reviewing:Neuropeptide Y (human,rat)
Rate this item:

Solubility & Handling

Storage instructions -20°C (desiccate)
Solubility overview Soluble in water (1.5 mg/ml)
Storage of solutions Prepare and use solutions on the same day if possible. Store solutions at -20°C for up to one month if storage is required. Equilibrate to RT and ensure the solution is precipitate free before use.
Shipping Conditions Stable for ambient temperature shipping. Follow storage instructions on receipt.
Important This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. Not for human or veterinary use

Calculators

Molarity

=
x
x
More Info

Dilution

x
=
x
More Info

Chemical Data

Purity >95%
Chemical name YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (Modifications: Tyr-36 = C-terminal amide)
Molecular Weight 4271.75
Chemical structure Neuropeptide Y (human,rat) [90880-35-6] Chemical Structure
Molecular Formula C189H285N55O57S
Sequence (one letter) YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Sequence (three letter) Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr
Modifications Modifications: Tyr-36 = C-terminal amide
CAS Number 90880-35-6
PubChem identifier 24868177
SMILES CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N)NC(=O)[C@H](CC2=CC=C(C=C2)O)NC(=O)[C@H](CC3=CN=CN3)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC4=CC=C(C=C4)O)NC(=O)[C@H](CC5=CC=C(C=C5)O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C)NC(=O)[C@@H]6CCCN6C(=O)[C@H](C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)CNC(=O)[C@@H]7CCCN7C(=O)[C@H](CC(=O)N)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H]8CCCN8C(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@@H]9CCCN9C(=O)[C@H](CC1=CC=C(C=C1)O)N
InChiKey XKWCTHKJQNUFOQ-HRPSIEBRSA-N
MDL number MFCD00212432
Protein length 36

References for Neuropeptide Y (human,rat)

References are publications that support the biological activity of the product
  • Neuropeptide Y in normal eating and in genetic and dietary-induced obesity.

    Beck B, (2006) Philos Trans R Soc Lond B Biol Sci. 361(1471) : 1159-85
  • Neuropeptide Y: some viewpoints on a multifaceted peptide in the normal and diseased nervous system.

    Hokfelt et al (1998) Brain Res 26(2-3) : 154-66
  • Neuropeptide Y: an overview of central distribution, functional aspects, and possible involvement in neuropsychiatric illnesses.

    Heilig et al (1990) Acta Psychiatr Scand. 82(2) : 95-114

3 Item(s)