The store will not work correctly in the case when cookies are disabled.
JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.
Solubility & Handling Storage instructions -20°C (desiccate)
Solubility overview Soluble in water (1.5 mg/ml)
Important This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. Not for human or veterinary use
Chemical Data Chemical name YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
(Modifications: Tyr-36 = C-terminal amide)
Chemical structure
Molecular Formula C189 H285 N55 O57 S
Sequence (one letter) YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Sequence (three letter) Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr
Modifications Modifications: Tyr-36 = C-terminal amide
PubChem identifier 24868177
SMILES CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N)NC(=O)[C@H](CC2=CC=C(C=C2)O)NC(=O)[C@H](CC3=CN=CN3)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC4=CC=C(C=C4)O)NC(=O)[C@H](CC5=CC=C(C=C5)O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C)NC(=O)[C@@H]6CCCN6C(=O)[C@H](C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)CNC(=O)[C@@H]7CCCN7C(=O)[C@H](CC(=O)N)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H]8CCCN8C(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@@H]9CCCN9C(=O)[C@H](CC1=CC=C(C=C1)O)N
InChiKey XKWCTHKJQNUFOQ-HRPSIEBRSA-N
References for Neuropeptide Y (human,rat) References are publications that support the biological activity of the product
Neuropeptide Y in normal eating and in genetic and dietary-induced obesity. Beck B, (2006) Philos Trans R Soc Lond B Biol Sci. 361(1471) : 1159-85 Neuropeptide Y: some viewpoints on a multifaceted peptide in the normal and diseased nervous system. Hokfelt et al (1998) Brain Res 26(2-3) : 154-66 Neuropeptide Y: an overview of central distribution, functional aspects, and possible involvement in neuropsychiatric illnesses. Heilig et al (1990) Acta Psychiatr Scand. 82(2) : 95-114
Widely distributed endogenous neuropeptide
![Neuropeptide Y (human,rat) [90880-35-6] Chemical Structure](https://hellobio.com/media/catalog/product//h/b/hb2935_1.png "Neuropeptide Y (human,rat) [90880-35-6]")
Understanding purity and quality - a guide for life scientists
