LL-37 (human)

(HB4444)

Certificate of Analysis

Latest Certificate of Analysis

Download the latest CoA for this product:

Download CoA

Download Batch-Specific CoA

To download the CoA for a batch, enter the batch ID below:

Technical documents: CoA SDS Datasheet

Product overview

Name LL-37 (human)
Biological description

Cell permeable antimicrobial host defense peptide derived from the C-terminal of human cathelicidin. Acts on host cells to exert immunomodulatory functions as part of its role in host defense and immunity. Mediates chemotaxis, promotes wound healing, angiogenesis and induces tumorigenic effects in various cancers.

Recently shown to reduce SARS-CoV-2 infection by blocking the S1 spike protein RBD (receptor binding domain) (Kd = 11.2 nM). LL-37 inhibits SARS-CoV-2 pseudovirion infection (IC50 = 4.74 µg/mL) in vitro and in vivo and also binds to ACE2 (Kd = 25.5 nM) to cloak the LBD (ligand binding domain) to decrease S1 adherence and protect cells against pseudovirion infection in vitro.

Displays antimicrobial, antibacterial, antitumour, anti-cancer and antiviral activities.

 

Control Peptide also available.

Alternative names Ropocamptide, hCAP 18, Cathelicidin
Purity >95%
Description

Antimicrobial peptide. Reduces SARS-Cov2 infection.

Write Your Own Review
You're reviewing:LL-37 (human)
Rate this item:

Solubility & Handling

Storage instructions -20°C
Solubility overview Soluble in aqueous buffer (1 mg/ml), and in DMSO
Storage of solutions Prepare and use solutions on the same day if possible. Store solutions at -20°C for up to one month if storage is required. Equilibrate to RT and ensure the solution is precipitate free before use.
Shipping Conditions Stable for ambient temperature shipping. Follow storage instructions on receipt.
Important This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. Not for human or veterinary use

Calculators

Molarity

=
x
x
More Info

Dilution

x
=
x
More Info

Chemical Data

Purity >95%
Molecular Weight 4493.3
Molecular Formula C205H340N60O53
Sequence (one letter) [LL-37, 37 aa]
Sequence (three letter) H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
CAS Number 154947-66-7
PubChem identifier 16198951
InChiKey POIUWJQBRNEFGX-XAMSXPGMSA-N

References for LL-37 (human)

References are publications that support the biological activity of the product
  • Human Cathelicidin Inhibits SARS-CoV-2 Infection: Killing Two Birds with One Stone

    Wang C et al (2021) ACS Infect Dis 7(6) : 1545-1554
  • Spotlight on Human LL-37, an Immunomodulatory Peptide with Promising Cell-Penetrating Properties

    Seil et al (2010) Pharmaceuticals (Basel). 3(11) : 3435-3460

2 Item(s)