The store will not work correctly in the case when cookies are disabled.
JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.
Solubility & Handling Storage instructions -20°C
Solubility overview Soluble in aqueous buffer
Important This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. Not for human or veterinary use
Chemical Data Molecular Formula C178 H302 N50 O46
Sequence (one letter) GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
Sequence (three letter) H-Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln-OH
References for mCRAMP (mouse) References are publications that support the biological activity of the product
The Antimicrobial Cathelicidin CRAMP Augments Platelet Activation during Psoriasis in Mice Salamah MF et al (2020) Biomolecules 10(9) : 0 Short, Synthetic Cationic Peptides Have Antibacterial Activity against Mycobacterium smegmatis by Forming Pores in Membrane and Synergizing with Antibiotics Gupta K et al (2015) Antibiotics (Basel) 4(3) : 358-78 The human antimicrobial peptide LL-37, but not the mouse ortholog, mCRAMP, can stimulate signaling by poly(I:C) through a FPRL1-dependent pathway Singh D et al (2013) J Biol Chem 288(12) : 8258-8268 Cathelicidin mediates innate intestinal defense against colonization with epithelial adherent bacterial pathogens Iimura M et al (2005) J Immunol 174(8) : 4901-7
Understanding purity and quality - a guide for life scientists
